(data stored in ACNUC7421 zone)

EMBL: CP001854.PE267

CP001854.PE267       Location/Qualifiers
FT   CDS             complement(273132..277070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0267"
FT                   /product="ATP-dependent helicase HrpA"
FT                   /note="KEGG: spe:Spro_2595 ATP-dependent RNA helicase HrpA;
FT                   TIGRFAM: ATP-dependent helicase HrpA; PFAM:
FT                   helicase-associated domain protein; protein of unknown
FT                   function DUF1605; helicase domain protein; SMART: DEAD-like
FT                   helicase; helicase domain protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48703"
FT                   /db_xref="GOA:D3F630"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010222"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3F630"
FT                   /inference="protein motif:TFAM:TIGR01967"
FT                   /protein_id="ADB48703.1"
FT                   /translation="MPSPSPPDAPLADLRARLTDLTLRDEHRIRRRFDRLRSTHGDDER
FT                   GAALMKIAADVEESEARVARRRASVPQVTYPPQLPVSARKDELLEAIRDNQVVVVAGET
FT                   GSGKTTQLPKICLELGRGVRGAIAHTQPRRLAARTVAERIAEELDVPLGDAVGYAVRFN
FT                   DKTSESTLVRLVTDGLLLAQIQRDPLLRRYDTIIVDEAHERSLNIDFLLGCIKRILPRR
FT                   PELKLIITSATIDPQRFSRHFGDAPIVEVSGRTYPVEVRYRPLAVEAPDGEEAPDDRDQ
FT                   IDAIGDAVQELRRESKGDVLVFLSGEREIRDTADALSGRFGDRLDVLPLYARLATAEQQ
FT                   RVFRPHSKQRVVLATNVAETSLTVPGIRYVVDPGSARISRYSARLKVQRLPIEAVSQAS
FT                   ADQRKGRCGRQSDGICIRLYSEQEFEARPRFTDPEILRTNLASVILQMAALGLGAIEEF
FT                   PFLEPPDRRQIRDGVLLLQELGALAEGELTPLGRKLAQLPVDPRLGRMVLEADRLDCAD
FT                   EAIVIAAALSIQDPRERPSEHQAQADQAHARFKDDDSDFTAFLSLWRYLREQQRAHNNS
FT                   QFRKRLKREFLHYLRVREWQDLAGQLREAARGVGVTLNQQPAEMAEVHRALLSGLLSHV
FT                   GMKETSARRRGEYLGARGARFMIFPGSGQARRQPAWVMAAELVETSRLWGRVVARIEPE
FT                   WVEALAEHLVRRTHSEPRWEKKRSEVVATERVTLYGLPIVGGRTVSYARIDPVLARELF
FT                   IRRALVEEDWHTRHHFFHDNRELIDQIEELEHRARRRDILVGDDVLFDFYDARIPADVV
FT                   SGAHFDRWWKQERQRDPRRLTFTLDLLADRDAAAGALDERARPESWTQGALRLPLTYHF
FT                   EPGAEHDGVTVHVPLPALAGLSEQGFEWLVPAFRLELITTLIRSLPKELRRPLVPVPDV
FT                   AAQVLAALTPEEPRSAQLLDTIARAIVRLRGVRVSPGDFDRGRLPAWLRMRFRIEEEDG
FT                   RLVAEGDDLEALRARVRPRLQAELTASAGSTLERSGLRSWTIGTLPRTVELPGTGGMAK
FT                   AYPALVDEGASVGVRVMDTPGEQWVAMHGGTRRLLLLSVPGATLKHVQGQLGATAALAL
FT                   ATAPHGSAAAVLDDAMNAAVDALMAEAGGPAWDAVGFARLRDHVAGNLVERTTAIVAQV
FT                   SRILALRGEIMERIATLAAPQYEAVRLDVARQAGRLVYPGFVAGTGVARLDDVERYLRG
FT                   AVHRLDRVPDHRAADADRMKAVHELEQAVQERRASWPPGRPFPPALFEVGWLLEELRMS
FT                   HFAQPLGVRGQVSSKRIRRALAEAWAAG"
     MPSPSPPDAP LADLRARLTD LTLRDEHRIR RRFDRLRSTH GDDERGAALM KIAADVEESE        60
     ARVARRRASV PQVTYPPQLP VSARKDELLE AIRDNQVVVV AGETGSGKTT QLPKICLELG       120
     RGVRGAIAHT QPRRLAARTV AERIAEELDV PLGDAVGYAV RFNDKTSEST LVRLVTDGLL       180
     LAQIQRDPLL RRYDTIIVDE AHERSLNIDF LLGCIKRILP RRPELKLIIT SATIDPQRFS       240
     RHFGDAPIVE VSGRTYPVEV RYRPLAVEAP DGEEAPDDRD QIDAIGDAVQ ELRRESKGDV       300
     LVFLSGEREI RDTADALSGR FGDRLDVLPL YARLATAEQQ RVFRPHSKQR VVLATNVAET       360
     SLTVPGIRYV VDPGSARISR YSARLKVQRL PIEAVSQASA DQRKGRCGRQ SDGICIRLYS       420
     EQEFEARPRF TDPEILRTNL ASVILQMAAL GLGAIEEFPF LEPPDRRQIR DGVLLLQELG       480
     ALAEGELTPL GRKLAQLPVD PRLGRMVLEA DRLDCADEAI VIAAALSIQD PRERPSEHQA       540
     QADQAHARFK DDDSDFTAFL SLWRYLREQQ RAHNNSQFRK RLKREFLHYL RVREWQDLAG       600
     QLREAARGVG VTLNQQPAEM AEVHRALLSG LLSHVGMKET SARRRGEYLG ARGARFMIFP       660
     GSGQARRQPA WVMAAELVET SRLWGRVVAR IEPEWVEALA EHLVRRTHSE PRWEKKRSEV       720
     VATERVTLYG LPIVGGRTVS YARIDPVLAR ELFIRRALVE EDWHTRHHFF HDNRELIDQI       780
     EELEHRARRR DILVGDDVLF DFYDARIPAD VVSGAHFDRW WKQERQRDPR RLTFTLDLLA       840
     DRDAAAGALD ERARPESWTQ GALRLPLTYH FEPGAEHDGV TVHVPLPALA GLSEQGFEWL       900
     VPAFRLELIT TLIRSLPKEL RRPLVPVPDV AAQVLAALTP EEPRSAQLLD TIARAIVRLR       960
     GVRVSPGDFD RGRLPAWLRM RFRIEEEDGR LVAEGDDLEA LRARVRPRLQ AELTASAGST      1020
     LERSGLRSWT IGTLPRTVEL PGTGGMAKAY PALVDEGASV GVRVMDTPGE QWVAMHGGTR      1080
     RLLLLSVPGA TLKHVQGQLG ATAALALATA PHGSAAAVLD DAMNAAVDAL MAEAGGPAWD      1140
     AVGFARLRDH VAGNLVERTT AIVAQVSRIL ALRGEIMERI ATLAAPQYEA VRLDVARQAG      1200
     RLVYPGFVAG TGVARLDDVE RYLRGAVHRL DRVPDHRAAD ADRMKAVHEL EQAVQERRAS      1260
     WPPGRPFPPA LFEVGWLLEE LRMSHFAQPL GVRGQVSSKR IRRALAEAWA AG              1312
//

If you have problems or comments...

PBIL Back to PBIL home page