(data stored in ACNUC7421 zone)

EMBL: CP001854.PE268

CP001854.PE268       Location/Qualifiers
FT   CDS             complement(277158..278000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0268"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bmn:BMA10247_2444 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48704"
FT                   /db_xref="GOA:D3F631"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D3F631"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADB48704.1"
FT                   /translation="MTALLLSLGASLAWGVSDFGGGTAARRYSTITVLLFMRIGGVLAM
FT                   GALALATTAPWVGSHWPFAVAAVATTIGGGLAMLRALAIGPMGIAAPIVAASGAVPAIF
FT                   GLATGRAPSTVALAGLAVAAAGAVLASRAPGHRGERVAPAGVGFALLAALLIGSSLLLM
FT                   HEASAESAVSAVLLERSLEALCLVLFVVLRPRLLSPTDGAGRLPLLAIGALESCAIVSF
FT                   AAASTLGSLTSAAVLSSLYPVVTVLLARALHDERLSRAQLAGALLTLAGVVVVVATSA"
     MTALLLSLGA SLAWGVSDFG GGTAARRYST ITVLLFMRIG GVLAMGALAL ATTAPWVGSH        60
     WPFAVAAVAT TIGGGLAMLR ALAIGPMGIA APIVAASGAV PAIFGLATGR APSTVALAGL       120
     AVAAAGAVLA SRAPGHRGER VAPAGVGFAL LAALLIGSSL LLMHEASAES AVSAVLLERS       180
     LEALCLVLFV VLRPRLLSPT DGAGRLPLLA IGALESCAIV SFAAASTLGS LTSAAVLSSL       240
     YPVVTVLLAR ALHDERLSRA QLAGALLTLA GVVVVVATSA                             280
//

If you have problems or comments...

PBIL Back to PBIL home page