(data stored in ACNUC7421 zone)

EMBL: CP001854.PE269

CP001854.PE269       Location/Qualifiers
FT   CDS             complement(278075..279091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0269"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   atc:AGR_pAT_447 DtxR/iron regulated lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48705"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D3F632"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADB48705.1"
FT                   /translation="MRSPLRLLLLPLLAAIAVALTACGSDDDAATTAGGSAAGGTGTSG
FT                   SAAGAFPVTIESRLGSAEIEAAPERVVALDFSSADAAIALGVELVGMARVDYAEGGIQP
FT                   WTKALLRGAEPELFSTADGYPVEQIAALRPDVLLAANPYRIADVYDELAQIAPVVTYET
FT                   AEGHDTWQRSTERIGQALGRTSAAQQLIEQTEQEVADARRAHPQFDGKTISLFNMVDRT
FT                   AWVISDAEDFSVRFLADLGMTLSPTVARLRSAEGRAQVSPERYDLLDADVVIATAFDPR
FT                   ELEGLEDHGVFGKLDAVRRSAYVALPLSPATSIAFPSAVSVRYALSEIVPQVDRAVG"
     MRSPLRLLLL PLLAAIAVAL TACGSDDDAA TTAGGSAAGG TGTSGSAAGA FPVTIESRLG        60
     SAEIEAAPER VVALDFSSAD AAIALGVELV GMARVDYAEG GIQPWTKALL RGAEPELFST       120
     ADGYPVEQIA ALRPDVLLAA NPYRIADVYD ELAQIAPVVT YETAEGHDTW QRSTERIGQA       180
     LGRTSAAQQL IEQTEQEVAD ARRAHPQFDG KTISLFNMVD RTAWVISDAE DFSVRFLADL       240
     GMTLSPTVAR LRSAEGRAQV SPERYDLLDA DVVIATAFDP RELEGLEDHG VFGKLDAVRR       300
     SAYVALPLSP ATSIAFPSAV SVRYALSEIV PQVDRAVG                               338
//

If you have problems or comments...

PBIL Back to PBIL home page