(data stored in ACNUC7421 zone)

EMBL: CP001854.PE270

CP001854.PE270       Location/Qualifiers
FT   CDS             279177..280301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0270"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: yen:YE1467 putative ABC transport ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48706"
FT                   /db_xref="GOA:D3F633"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3F633"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB48706.1"
FT                   /translation="MSETPAIRTTGLRKVYRRGGADVVALDGVDLTVPRGQVFGVLGTS
FT                   GAGKSTLIRTVNGLERATAGSVEVGGVELTRLRGAALREQRRKIGMVFQHFNLLTSRTA
FT                   AQNVALPLEIVGVDRRERRERAQRLLELVGLGDQADAYPAQLSGGQKQRVGIARALAAE
FT                   PSVLLSDEATSALDEQTAASVLALLRDLNERLGLTIVLVTHQLSVVKQMADAAVLLRDG
FT                   RAVDAGTLADAAARPTSPLGRVLLPALPDDASAADARRDAHAGSLGGAADGSAAADGRE
FT                   LLDLVVVGDAARGVVAPLDAAADEPVRAALRAADVRYDVLAAVYEPVGGRPVARLRLAL
FT                   AGTADARAGARRALAAAGANPQQPVAETVQEPVA"
     MSETPAIRTT GLRKVYRRGG ADVVALDGVD LTVPRGQVFG VLGTSGAGKS TLIRTVNGLE        60
     RATAGSVEVG GVELTRLRGA ALREQRRKIG MVFQHFNLLT SRTAAQNVAL PLEIVGVDRR       120
     ERRERAQRLL ELVGLGDQAD AYPAQLSGGQ KQRVGIARAL AAEPSVLLSD EATSALDEQT       180
     AASVLALLRD LNERLGLTIV LVTHQLSVVK QMADAAVLLR DGRAVDAGTL ADAAARPTSP       240
     LGRVLLPALP DDASAADARR DAHAGSLGGA ADGSAAADGR ELLDLVVVGD AARGVVAPLD       300
     AAADEPVRAA LRAADVRYDV LAAVYEPVGG RPVARLRLAL AGTADARAGA RRALAAAGAN       360
     PQQPVAETVQ EPVA                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page