(data stored in ACNUC7421 zone)

EMBL: CP001854.PE271

CP001854.PE271       Location/Qualifiers
FT   CDS             280298..280951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0271"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rpf:Rpic12D_0862
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48707"
FT                   /db_xref="GOA:D3F634"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3F634"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB48707.1"
FT                   /translation="MSDDLVPLIREATGETLQMVGVAMLFTIPLGLLLGALLLLTDRGG
FT                   ALRQPVVNWVLGFVVNVGRSVPFIILLIAVIPFTRLVVGTTIGTTAAIVPLTLATIPFF
FT                   ARIVETSLREVPGGLVEAAQAAGANGRQVVFKVLVPEALPSLVAGVTITTIGVLGYSAM
FT                   AGAVGGGGLGDVAIRYGYQRYETDVTIATVVVLVVLVAVIQFAGDRLARHLSHA"
     MSDDLVPLIR EATGETLQMV GVAMLFTIPL GLLLGALLLL TDRGGALRQP VVNWVLGFVV        60
     NVGRSVPFII LLIAVIPFTR LVVGTTIGTT AAIVPLTLAT IPFFARIVET SLREVPGGLV       120
     EAAQAAGANG RQVVFKVLVP EALPSLVAGV TITTIGVLGY SAMAGAVGGG GLGDVAIRYG       180
     YQRYETDVTI ATVVVLVVLV AVIQFAGDRL ARHLSHA                                217
//

If you have problems or comments...

PBIL Back to PBIL home page