(data stored in ACNUC7421 zone)

EMBL: CP001854.PE272

CP001854.PE272       Location/Qualifiers
FT   CDS             280974..281840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0272"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: maq:Maqu_0253 NlpA
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48708"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D3F635"
FT                   /inference="protein motif:PFAM:PF03180"
FT                   /protein_id="ADB48708.1"
FT                   /translation="MRRIVLLPLLLVLLAIGVAACGSDDDGDSTAAATAAGTAAANAGR
FT                   PSSEPLRVGATPVPHVEILQFVQDELAARAGLTLDIREFTDYVVPNTALDEGQLDANYF
FT                   QTPGYLEDQSRARGYDFVSVADVHIEPLGIYSSKVRSLDEIADGATVAVPNDPANEARA
FT                   LRLLDAEGVISLEDPDSETATPRDIAENPKDLEFEEVEAAQTPRALDDVDLAVINGNYA
FT                   LEARLSPAEDALALERAAGNPNVNLLVTTPDLESDPRIVELARLLRSPQVRRFIADRYR
FT                   GAVIPAE"
     MRRIVLLPLL LVLLAIGVAA CGSDDDGDST AAATAAGTAA ANAGRPSSEP LRVGATPVPH        60
     VEILQFVQDE LAARAGLTLD IREFTDYVVP NTALDEGQLD ANYFQTPGYL EDQSRARGYD       120
     FVSVADVHIE PLGIYSSKVR SLDEIADGAT VAVPNDPANE ARALRLLDAE GVISLEDPDS       180
     ETATPRDIAE NPKDLEFEEV EAAQTPRALD DVDLAVINGN YALEARLSPA EDALALERAA       240
     GNPNVNLLVT TPDLESDPRI VELARLLRSP QVRRFIADRY RGAVIPAE                    288
//

If you have problems or comments...

PBIL Back to PBIL home page