(data stored in ACNUC7421 zone)

EMBL: CP001854.PE273

CP001854.PE273       Location/Qualifiers
FT   CDS             282076..283395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0273"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   scl:sce1210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48709"
FT                   /db_xref="GOA:D3F636"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3F636"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ADB48709.1"
FT                   /translation="MSIAAIRTPVAGALLSVVGEQLRVPLVGGGETRYANLDYGATAPA
FT                   LSAVAERITRVLPYYGSVHRGSGLPARVSTALYEQARGTVARFAGARPDDAVVFTRNTT
FT                   DALNLLASAVPAGAGDVVFLDSEHHANLLPWRRGPHRELAVAPTLEETLARLGDALAAA
FT                   PVALVAITGASNVTGELLPLERVVALAHGAGARVVVDAAQLAPHRRVDLARIGADYLAL
FT                   SGHKLYAPYGSGVLIGRSDWLDAAPPYLAGGGAVRDVTAEDVVWHDGPARHEAGTPNLL
FT                   GAVALAAACDALDELAPGALEAHEASLRELLLARLTRIPGVRVARIWSDSRDAIGTVAF
FT                   TVEGWEPAHVGAYLSAEHGVGVRDGRFCAHQLLARLGLGPARAGALRASFGVGTSVEDV
FT                   ERLADALERLVRDGSRWAYAPGPDGWAPVGDDRPLPELLA"
     MSIAAIRTPV AGALLSVVGE QLRVPLVGGG ETRYANLDYG ATAPALSAVA ERITRVLPYY        60
     GSVHRGSGLP ARVSTALYEQ ARGTVARFAG ARPDDAVVFT RNTTDALNLL ASAVPAGAGD       120
     VVFLDSEHHA NLLPWRRGPH RELAVAPTLE ETLARLGDAL AAAPVALVAI TGASNVTGEL       180
     LPLERVVALA HGAGARVVVD AAQLAPHRRV DLARIGADYL ALSGHKLYAP YGSGVLIGRS       240
     DWLDAAPPYL AGGGAVRDVT AEDVVWHDGP ARHEAGTPNL LGAVALAAAC DALDELAPGA       300
     LEAHEASLRE LLLARLTRIP GVRVARIWSD SRDAIGTVAF TVEGWEPAHV GAYLSAEHGV       360
     GVRDGRFCAH QLLARLGLGP ARAGALRASF GVGTSVEDVE RLADALERLV RDGSRWAYAP       420
     GPDGWAPVGD DRPLPELLA                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page