(data stored in ACNUC7421 zone)

EMBL: CP001854.PE274

CP001854.PE274       Location/Qualifiers
FT   CDS             complement(283465..284787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0274"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: ilo:IL0161 secreted subtilisin-like
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48710"
FT                   /db_xref="GOA:D3F637"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034204"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D3F637"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADB48710.1"
FT                   /translation="MNGHRTSHRARRRTLALAAATGLLSVAAPAAAPATAAAAPPAVAG
FT                   QLLVGFERGVSKARQTQLLDTAGARIARRYDAVRGGRLVLVRARGGAALSAIRSRLSRA
FT                   GGVAYAEPDYVLAATQTRTPDDPLYSRQYALVDGPAGHDVDAPTAWARRTSCARVAILD
FT                   TGIDTDHPDLAANVYKSADKPNNGKDDDHNGYVDDTYGFDAAAGKGSGEDDDGHGTHVA
FT                   GIVAARTNDALGVAGTCWSAKLLAVKFMNSRGKGSTSNAIAGIQYAVRQGVKIVNCSFG
FT                   SSANSSSLKDAIGYAQDHGVLLVVAAGNDSENIDRQPSYPASYANSNILTVAASDDEDR
FT                   LASFSDYGATAVDVAAPGDDILSTYLGGGYKTLSGTSMAAPYVAGVAALLRKQEPDASY
FT                   ADLRYAIRGHADAVPALSGKVASGGRLNAAKALAAIPALVD"
     MNGHRTSHRA RRRTLALAAA TGLLSVAAPA AAPATAAAAP PAVAGQLLVG FERGVSKARQ        60
     TQLLDTAGAR IARRYDAVRG GRLVLVRARG GAALSAIRSR LSRAGGVAYA EPDYVLAATQ       120
     TRTPDDPLYS RQYALVDGPA GHDVDAPTAW ARRTSCARVA ILDTGIDTDH PDLAANVYKS       180
     ADKPNNGKDD DHNGYVDDTY GFDAAAGKGS GEDDDGHGTH VAGIVAARTN DALGVAGTCW       240
     SAKLLAVKFM NSRGKGSTSN AIAGIQYAVR QGVKIVNCSF GSSANSSSLK DAIGYAQDHG       300
     VLLVVAAGND SENIDRQPSY PASYANSNIL TVAASDDEDR LASFSDYGAT AVDVAAPGDD       360
     ILSTYLGGGY KTLSGTSMAA PYVAGVAALL RKQEPDASYA DLRYAIRGHA DAVPALSGKV       420
     ASGGRLNAAK ALAAIPALVD                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page