(data stored in ACNUC7421 zone)

EMBL: CP001854.PE275

CP001854.PE275       Location/Qualifiers
FT   CDS             complement(284857..286059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0275"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: scl:sce6437 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48711"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D3F638"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ADB48711.1"
FT                   /translation="MKTIRTTLALAAGLTLLTGAAAGTAAAAPTQLSAIDLDAALDTAL
FT                   ADSGAPGATVAVLDRGELVWSGAAGLAVDPSAAPMRLGAASAPAAVAMRTDTLQPIASL
FT                   TKSYTAVVILRLAEQRKLRLDATIDDWLPAVPGARTVTVRQLLQHTAGYPDVEADPYVT
FT                   RITSTRRRYDPDHRWTRAELIRLTRAPAFTPGTSWSYSNTNYLLLGEIAERAARAPFAR
FT                   LLDRYVARPLKLRDTLIRRSALPLQRFAHGYYFTAKTRFDTWSAARSVPSDAFGPVWTD
FT                   GGIATTALDAARFSDGLYRAGALLRPRTLATMTHTPGARFRGHGLGTKRFAFGDGARWQ
FT                   GFIGAYGGYTSMAATNRDSGITIAVLSNQLGIDPVTAPAPAIWVRIGQALGAVPDRAAL
FT                   G"
     MKTIRTTLAL AAGLTLLTGA AAGTAAAAPT QLSAIDLDAA LDTALADSGA PGATVAVLDR        60
     GELVWSGAAG LAVDPSAAPM RLGAASAPAA VAMRTDTLQP IASLTKSYTA VVILRLAEQR       120
     KLRLDATIDD WLPAVPGART VTVRQLLQHT AGYPDVEADP YVTRITSTRR RYDPDHRWTR       180
     AELIRLTRAP AFTPGTSWSY SNTNYLLLGE IAERAARAPF ARLLDRYVAR PLKLRDTLIR       240
     RSALPLQRFA HGYYFTAKTR FDTWSAARSV PSDAFGPVWT DGGIATTALD AARFSDGLYR       300
     AGALLRPRTL ATMTHTPGAR FRGHGLGTKR FAFGDGARWQ GFIGAYGGYT SMAATNRDSG       360
     ITIAVLSNQL GIDPVTAPAP AIWVRIGQAL GAVPDRAALG                             400
//

If you have problems or comments...

PBIL Back to PBIL home page