(data stored in ACNUC7421 zone)

EMBL: CP001854.PE276

CP001854.PE276       Location/Qualifiers
FT   CDS             complement(286189..286842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0276"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_2196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48712"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D3F639"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48712.1"
FT                   /translation="MGRHPARRSDDAHAPEARPASAIGAMARGASAFGSSVFGATAMGA
FT                   LAVGRAAIGRLAIRRATVTRLEIDELIVGRLQIDAGGAATREQVAAWLDAYERAWRTPG
FT                   TDVLADLFTDDATYSPGPFRETLSGRPAIAAFWEDGRDGADERFAMRSELLAVEGDVGV
FT                   VRVEVDYERPEPSSFRDLWVVAFAPDGRCRAFEEWPFAPGDRLSPGAPPAPSDA"
     MGRHPARRSD DAHAPEARPA SAIGAMARGA SAFGSSVFGA TAMGALAVGR AAIGRLAIRR        60
     ATVTRLEIDE LIVGRLQIDA GGAATREQVA AWLDAYERAW RTPGTDVLAD LFTDDATYSP       120
     GPFRETLSGR PAIAAFWEDG RDGADERFAM RSELLAVEGD VGVVRVEVDY ERPEPSSFRD       180
     LWVVAFAPDG RCRAFEEWPF APGDRLSPGA PPAPSDA                                217
//

If you have problems or comments...

PBIL Back to PBIL home page