(data stored in ACNUC7421 zone)

EMBL: CP001854.PE277

CP001854.PE277       Location/Qualifiers
FT   CDS             286908..287597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0277"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="PFAM: regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: dol:Dole_2617 regulatory protein
FT                   GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48713"
FT                   /db_xref="GOA:D3F640"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3F640"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADB48713.1"
FT                   /translation="MSTSDTPARRVSDVVHERLRQQILGGDLAVGAAVPSERVLADELG
FT                   VNRHAVREALKRLEQAGLVQISQGGPTRVRDWRESGGLEVLLDLVDHPGELPPEELVRA
FT                   VLELRACIGTDAARRCAARAPLAVREQAARLAAATAATAETDPEAAVASYEALWQAIVA
FT                   GAGNLAHRLALNSLLAALDSFPALAAALLPRDVDSLLLLGSALLSGDDAAAAAAARTLL
FT                   EADLSSA"
     MSTSDTPARR VSDVVHERLR QQILGGDLAV GAAVPSERVL ADELGVNRHA VREALKRLEQ        60
     AGLVQISQGG PTRVRDWRES GGLEVLLDLV DHPGELPPEE LVRAVLELRA CIGTDAARRC       120
     AARAPLAVRE QAARLAAATA ATAETDPEAA VASYEALWQA IVAGAGNLAH RLALNSLLAA       180
     LDSFPALAAA LLPRDVDSLL LLGSALLSGD DAAAAAAART LLEADLSSA                   229
//

If you have problems or comments...

PBIL Back to PBIL home page