(data stored in ACNUC7421 zone)

EMBL: CP001854.PE279

CP001854.PE279       Location/Qualifiers
FT   CDS             288290..289078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0279"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mca:MCA2122 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48715"
FT                   /db_xref="GOA:D3F642"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3F642"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB48715.1"
FT                   /translation="MAGAPALHIADLTKRYPTGTEALRGVSLDIAAGEFFGLLGRNGAG
FT                   KSTLIHCTTGLVRPTSGAIRVFGHDAVDDYEQARTAVGLAPQELNFDWFLTLEETLDYH
FT                   GGYFGMPRKERRARSAELLEAFSLSEKRRERAMTLSGGMKRRLILARALMHRPRLLILD
FT                   EPTAGVDVELRLELWRYVRRINAEGTTILLTTHYLEEAEELCDRIAFIDGGRIVAEGTS
FT                   ASLTAEYGVETLEDAYLELAGRRELARGRLDDVAAAEVAS"
     MAGAPALHIA DLTKRYPTGT EALRGVSLDI AAGEFFGLLG RNGAGKSTLI HCTTGLVRPT        60
     SGAIRVFGHD AVDDYEQART AVGLAPQELN FDWFLTLEET LDYHGGYFGM PRKERRARSA       120
     ELLEAFSLSE KRRERAMTLS GGMKRRLILA RALMHRPRLL ILDEPTAGVD VELRLELWRY       180
     VRRINAEGTT ILLTTHYLEE AEELCDRIAF IDGGRIVAEG TSASLTAEYG VETLEDAYLE       240
     LAGRRELARG RLDDVAAAEV AS                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page