(data stored in ACNUC7421 zone)

EMBL: CP001854.PE28

CP001854.PE28        Location/Qualifiers
FT   CDS             30297..30473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48464"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Y1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48464.1"
FT                   /translation="MPDRVPQQDAELAALLARLALDDLPEPLVRAVVESLEWAVRLDRE
FT                   AASRVERGPTRPR"
     MPDRVPQQDA ELAALLARLA LDDLPEPLVR AVVESLEWAV RLDREAASRV ERGPTRPR          58
//

If you have problems or comments...

PBIL Back to PBIL home page