(data stored in ACNUC7421 zone)

EMBL: CP001854.PE280

CP001854.PE280       Location/Qualifiers
FT   CDS             289075..289845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0280"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: vha:VIBHAR_03454
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48716"
FT                   /db_xref="GOA:D3F643"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D3F643"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADB48716.1"
FT                   /translation="MSAAQIRFLTLLRREVNRFMKIKKQTLGAPLLETFLYVSVFGAAL
FT                   GASIDRQPGGVRYVVFIVPGLIMMGLAINAFANNSSSILQQKFQRAIDDQLSSPASPLE
FT                   LLLALSLGGFLRGMIVAALTFVAAWLLVDLPVEHVLVLVPSLALVGFFFAQLGVLIGVR
FT                   AEQFDDVSFPQTFILQPLVFLGGVFYTVSVLPEPFETLTHFNPVYYMVGLIRYGFIGYS
FT                   EINVALSLALLTVATVALFAFNLRLFARGYKLRG"
     MSAAQIRFLT LLRREVNRFM KIKKQTLGAP LLETFLYVSV FGAALGASID RQPGGVRYVV        60
     FIVPGLIMMG LAINAFANNS SSILQQKFQR AIDDQLSSPA SPLELLLALS LGGFLRGMIV       120
     AALTFVAAWL LVDLPVEHVL VLVPSLALVG FFFAQLGVLI GVRAEQFDDV SFPQTFILQP       180
     LVFLGGVFYT VSVLPEPFET LTHFNPVYYM VGLIRYGFIG YSEINVALSL ALLTVATVAL       240
     FAFNLRLFAR GYKLRG                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page