(data stored in ACNUC7421 zone)

EMBL: CP001854.PE281

CP001854.PE281       Location/Qualifiers
FT   CDS             290053..290997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0281"
FT                   /product="fatty acid hydroxylase"
FT                   /note="PFAM: fatty acid hydroxylase; KEGG: mxa:MXAN_6907
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48717"
FT                   /db_xref="GOA:D3F644"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:D3F644"
FT                   /inference="protein motif:PFAM:PF04116"
FT                   /protein_id="ADB48717.1"
FT                   /translation="MLEVFLAAIPFFLLSIALEAFVLAHHAREDRAGGAGGGGGGMLGY
FT                   ERRDTRTSLAMGAGHLVVLGAWKIVVLAVFAALYSLSPLRVPTDAWWGWVLLFFADDVA
FT                   FYLHHRAHHRIRLFWAQHVVHHSSERYNLSTALRQDWTPFSTGIFWLWMPLAGFAPWTI
FT                   FLAQSWSLLCQFGLHTETIRTLPRPIEWIFNTPSHHRVHHGSQQQYLDRNYGGILIVWD
FT                   RLFGTFEPERERVRYGLTRNIDTFNPVRVAFHEYAAIWHDVRTATSWRARLGYAFRGPG
FT                   WRPASRELSTEQERAVLDRCPPATPIQDDALTR"
     MLEVFLAAIP FFLLSIALEA FVLAHHARED RAGGAGGGGG GMLGYERRDT RTSLAMGAGH        60
     LVVLGAWKIV VLAVFAALYS LSPLRVPTDA WWGWVLLFFA DDVAFYLHHR AHHRIRLFWA       120
     QHVVHHSSER YNLSTALRQD WTPFSTGIFW LWMPLAGFAP WTIFLAQSWS LLCQFGLHTE       180
     TIRTLPRPIE WIFNTPSHHR VHHGSQQQYL DRNYGGILIV WDRLFGTFEP ERERVRYGLT       240
     RNIDTFNPVR VAFHEYAAIW HDVRTATSWR ARLGYAFRGP GWRPASRELS TEQERAVLDR       300
     CPPATPIQDD ALTR                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page