(data stored in ACNUC7421 zone)

EMBL: CP001854.PE282

CP001854.PE282       Location/Qualifiers
FT   CDS             complement(290994..291878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48718"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:D3F645"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48718.1"
FT                   /translation="MIDLANAETFMATHARLLDRRRLAVLLGQEEPAGLLAALSAYRNP
FT                   DGGFGWALEADLRSPSSQPAGALHAFEVLEEAAPATSPMGAALCDWLATATLPGGGLPF
FT                   SVAGAAGPGTARWWAGADPGVPSLHITAAVAGHALRAAAHDPTVAAHPWLAQVTDWTLE
FT                   RIAAQEQPGHAYELKYTLQFLDAALGARPEAEGLMERTAAFVPASGELAVAGGVEGEKL
FT                   RSLEIAPLPDRPLRRLMPAAAIARQLDELEARQQPDGGWTVDFPSSSVAAALEWRGVAT
FT                   VLALITLRANQRA"
     MIDLANAETF MATHARLLDR RRLAVLLGQE EPAGLLAALS AYRNPDGGFG WALEADLRSP        60
     SSQPAGALHA FEVLEEAAPA TSPMGAALCD WLATATLPGG GLPFSVAGAA GPGTARWWAG       120
     ADPGVPSLHI TAAVAGHALR AAAHDPTVAA HPWLAQVTDW TLERIAAQEQ PGHAYELKYT       180
     LQFLDAALGA RPEAEGLMER TAAFVPASGE LAVAGGVEGE KLRSLEIAPL PDRPLRRLMP       240
     AAAIARQLDE LEARQQPDGG WTVDFPSSSV AAALEWRGVA TVLALITLRA NQRA             294
//

If you have problems or comments...

PBIL Back to PBIL home page