(data stored in ACNUC7421 zone)

EMBL: CP001854.PE283

CP001854.PE283       Location/Qualifiers
FT   CDS             291984..292442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0283"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: mlo:mlr0267 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48719"
FT                   /db_xref="GOA:D3F646"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:D3F646"
FT                   /inference="protein motif:PFAM:PF01152"
FT                   /protein_id="ADB48719.1"
FT                   /translation="MTTLYDYAGGRDAIVRLAEIHYGRCLTDPVLSQVFGTQGSATHAG
FT                   HLADWLTEVFGGPKLYTERHGGHEALLRHHANRSIAEPQRARFVAVFLESCDAAGLPAE
FT                   PRFRERLREYLEWGTAIALDVSQPGADVTSDDPVPVWDWGPAGPPPRA"
     MTTLYDYAGG RDAIVRLAEI HYGRCLTDPV LSQVFGTQGS ATHAGHLADW LTEVFGGPKL        60
     YTERHGGHEA LLRHHANRSI AEPQRARFVA VFLESCDAAG LPAEPRFRER LREYLEWGTA       120
     IALDVSQPGA DVTSDDPVPV WDWGPAGPPP RA                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page