(data stored in ACNUC7421 zone)

EMBL: CP001854.PE284

CP001854.PE284       Location/Qualifiers
FT   CDS             complement(292378..293376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0284"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein;
FT                   regulatory protein DeoR; protein of unknown function
FT                   UPF0074; KEGG: scl:sce5223 DeoR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48720"
FT                   /db_xref="GOA:D3F647"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3F647"
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /protein_id="ADB48720.1"
FT                   /translation="MLETSGRLLRLLSLLQTRREWSGTDLAERLDVTTRTVRRDVDKLR
FT                   ELGYPVDATRGVAGGYRLGAGAELPPLLLDDEEAIAVAVGLRTATNGTVAGIEESSVRA
FT                   LAKLEQVLPNRLRRRVAALGAFTAALPNPGAAVDHELLSLIASAARDGERLRFAYRRYD
FT                   GTSARRLVEPSRLVHADRRWYLVAWDVERDDWRTFRVDRIDGTPMRDRRFEPREPPEED
FT                   VAAYVERNVVRARGRKEGRVLLHIPREEAARQVPQLTAALTAVDDDTCLLTTADDWWGG
FT                   LAVYVASMRCEFEVLDPPEFVAEVERLAEAFTRAAAAPRDPSPRRGPDRRS"
     MLETSGRLLR LLSLLQTRRE WSGTDLAERL DVTTRTVRRD VDKLRELGYP VDATRGVAGG        60
     YRLGAGAELP PLLLDDEEAI AVAVGLRTAT NGTVAGIEES SVRALAKLEQ VLPNRLRRRV       120
     AALGAFTAAL PNPGAAVDHE LLSLIASAAR DGERLRFAYR RYDGTSARRL VEPSRLVHAD       180
     RRWYLVAWDV ERDDWRTFRV DRIDGTPMRD RRFEPREPPE EDVAAYVERN VVRARGRKEG       240
     RVLLHIPREE AARQVPQLTA ALTAVDDDTC LLTTADDWWG GLAVYVASMR CEFEVLDPPE       300
     FVAEVERLAE AFTRAAAAPR DPSPRRGPDR RS                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page