(data stored in ACNUC7421 zone)

EMBL: CP001854.PE285

CP001854.PE285       Location/Qualifiers
FT   CDS             293439..294593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0285"
FT                   /product="Epoxide hydrolase domain protein"
FT                   /note="PFAM: Epoxide hydrolase domain protein; KEGG:
FT                   reh:H16_A1793 epoxide hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48721"
FT                   /db_xref="GOA:D3F648"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3F648"
FT                   /inference="protein motif:PFAM:PF06441"
FT                   /protein_id="ADB48721.1"
FT                   /translation="MTNSTAASTAVRPFTIDVPQADLDDLRDRLARTRWVDELPGAGTD
FT                   YGMPLATVRALADHWQDSFDWRAQEAKLNELPHFVTEIDGEQIHFLHIRSPHADALPLV
FT                   MTHGWPKTFTELLALVGPLTDPVAHGGEAKDAFHVVIPSPPGYAFSGPTRSKGWNYPRI
FT                   ARAWDTLMKRLGYARYGAQGGDLGSLVGLALGRLAPEGLIGTHVMQIFAFPSGDPAELE
FT                   KLDEHDRAGERIGEDFMAKAGYHAMSSSRPNTIGTALNDSPAGTLAWLLELPTNWGETP
FT                   LDQLDKDALLTDVTIYWVTRTVASAARIYYEDAHSGEDWDANNPTPTGVAVFPWDFQSV
FT                   RAFAERANTNIVHWKRMEYGSHFAAIDAPELLVADLREFYGGLR"
     MTNSTAASTA VRPFTIDVPQ ADLDDLRDRL ARTRWVDELP GAGTDYGMPL ATVRALADHW        60
     QDSFDWRAQE AKLNELPHFV TEIDGEQIHF LHIRSPHADA LPLVMTHGWP KTFTELLALV       120
     GPLTDPVAHG GEAKDAFHVV IPSPPGYAFS GPTRSKGWNY PRIARAWDTL MKRLGYARYG       180
     AQGGDLGSLV GLALGRLAPE GLIGTHVMQI FAFPSGDPAE LEKLDEHDRA GERIGEDFMA       240
     KAGYHAMSSS RPNTIGTALN DSPAGTLAWL LELPTNWGET PLDQLDKDAL LTDVTIYWVT       300
     RTVASAARIY YEDAHSGEDW DANNPTPTGV AVFPWDFQSV RAFAERANTN IVHWKRMEYG       360
     SHFAAIDAPE LLVADLREFY GGLR                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page