(data stored in ACNUC7421 zone)

EMBL: CP001854.PE286

CP001854.PE286       Location/Qualifiers
FT   CDS             294606..295733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afw:Anae109_3510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48722"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:D3F649"
FT                   /inference="similar to AA sequence:KEGG:Anae109_3510"
FT                   /protein_id="ADB48722.1"
FT                   /translation="MPRVRTITDRELTLSLLARQLLLERRRLPAAEAVRRLVALQAQYS
FT                   PSPYIALHARVEGFAIADLERALRRGTVVKSTLMRGTLHLVHAAAYPAYASAWRFQARR
FT                   MLAPRERALDGGAPALVAALADFLREPRTTDEIRALVRELTDGRLSDGSEGLDFARGSL
FT                   PLVHVPPSGLWRQHGKFSLVRWETSGRGRAAVPEDPAAGTVALVRDYLAAFGPSTREDL
FT                   AAFTWLRFHQLDPALSALEPLRRLTDARGRELLDLPRAPLPREDVATPVRFLAKWDAAI
FT                   ISHRDRTRIVPPGFAQQVYAARNGEVAPTFLVDGQVAGTWRDREEDGEAVLEARSLIGG
FT                   SGSLPPDFEQEAERLLALLHPAARRRRVELVRDAA"
     MPRVRTITDR ELTLSLLARQ LLLERRRLPA AEAVRRLVAL QAQYSPSPYI ALHARVEGFA        60
     IADLERALRR GTVVKSTLMR GTLHLVHAAA YPAYASAWRF QARRMLAPRE RALDGGAPAL       120
     VAALADFLRE PRTTDEIRAL VRELTDGRLS DGSEGLDFAR GSLPLVHVPP SGLWRQHGKF       180
     SLVRWETSGR GRAAVPEDPA AGTVALVRDY LAAFGPSTRE DLAAFTWLRF HQLDPALSAL       240
     EPLRRLTDAR GRELLDLPRA PLPREDVATP VRFLAKWDAA IISHRDRTRI VPPGFAQQVY       300
     AARNGEVAPT FLVDGQVAGT WRDREEDGEA VLEARSLIGG SGSLPPDFEQ EAERLLALLH       360
     PAARRRRVEL VRDAA                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page