(data stored in ACNUC7421 zone)

EMBL: CP001854.PE29

CP001854.PE29        Location/Qualifiers
FT   CDS             complement(30457..31269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0029"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, FliA/WhiG
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   sigma-70 region 4 domain protein; sigma-70 region 2 domain
FT                   protein; Sigma-70 region 4 type 2; KEGG: dar:Daro_0743
FT                   sigma-70 region 4"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48465"
FT                   /db_xref="GOA:D3F3Y2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Y2"
FT                   /inference="protein motif:TFAM:TIGR02479"
FT                   /protein_id="ADB48465.1"
FT                   /translation="MKLDTRRHNRISAEDALALWRQYKESGDRAVRDRLVLTFAPMVKY
FT                   IVYKKVREIPARCEVEDFISCGLEALIHSIERYDPEKGATLEQFSWTRIHGAVLDELRR
FT                   QDWAPRSLRRWERDINQAREHFIGVHSRRPSREELAGALGTTPAELRAREDEIVASDVT
FT                   SLNTLVLSDDETAIERIDTLVSEDRFADPEHHTARDQAKMRFREAFERLPRREREVAVL
FT                   LYVKNLTLREIGGILGVSESRVCQIHGQLKRMLKEELIADSVLFSEVA"
     MKLDTRRHNR ISAEDALALW RQYKESGDRA VRDRLVLTFA PMVKYIVYKK VREIPARCEV        60
     EDFISCGLEA LIHSIERYDP EKGATLEQFS WTRIHGAVLD ELRRQDWAPR SLRRWERDIN       120
     QAREHFIGVH SRRPSREELA GALGTTPAEL RAREDEIVAS DVTSLNTLVL SDDETAIERI       180
     DTLVSEDRFA DPEHHTARDQ AKMRFREAFE RLPRREREVA VLLYVKNLTL REIGGILGVS       240
     ESRVCQIHGQ LKRMLKEELI ADSVLFSEVA                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page