(data stored in ACNUC7421 zone)

EMBL: CP001854.PE3

CP001854.PE3         Location/Qualifiers
FT   CDS             2691..3803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: mxa:MXAN_0246 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48439"
FT                   /db_xref="GOA:D3EYQ6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYQ6"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADB48439.1"
FT                   /translation="MRIVRLALRNFRSYPTAEVELGAGLTVVSGRNGAGKTNLLDALYF
FT                   GCTGRSARTTNDRELVRFGEQVTRVVVMTEADDGAHELSVAFESGQPKRLMADGVRVER
FT                   LLDVPGRPLVSVFLPDRLELVKGTPSLRRAHIDQVVAALWPARAATRRAYAQALAQRNA
FT                   LVARIRAGGASAASLPAWDRELARHGVALMADRAAAIESVQTRFGTIAGELGLDGDPAV
FT                   AYRPRSRAADAGGLEEELAERHASDLERGFTQHGPHRDDLALTRERRELRAYGSQGQQR
FT                   LTLLALLLAEREAIAATRDAVPVMLLDDVMSELDRERRGRLVELLRGVGQSVITTTDLE
FT                   HVPGAEGADVTRLSVRDGVVGADAQTERAA"
     MRIVRLALRN FRSYPTAEVE LGAGLTVVSG RNGAGKTNLL DALYFGCTGR SARTTNDREL        60
     VRFGEQVTRV VVMTEADDGA HELSVAFESG QPKRLMADGV RVERLLDVPG RPLVSVFLPD       120
     RLELVKGTPS LRRAHIDQVV AALWPARAAT RRAYAQALAQ RNALVARIRA GGASAASLPA       180
     WDRELARHGV ALMADRAAAI ESVQTRFGTI AGELGLDGDP AVAYRPRSRA ADAGGLEEEL       240
     AERHASDLER GFTQHGPHRD DLALTRERRE LRAYGSQGQQ RLTLLALLLA EREAIAATRD       300
     AVPVMLLDDV MSELDRERRG RLVELLRGVG QSVITTTDLE HVPGAEGADV TRLSVRDGVV       360
     GADAQTERAA                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page