(data stored in ACNUC7421 zone)

EMBL: CP001854.PE30

CP001854.PE30        Location/Qualifiers
FT   CDS             31559..33952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0030"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2;
FT                   Tetratricopeptide TPR_4; TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide repeat; KEGG: acp:A2cp1_2617 glycosyl
FT                   transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48466"
FT                   /db_xref="GOA:D3F3Y3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Y3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB48466.1"
FT                   /translation="MAPRPLNGSTPPLQAQAAALLRRGDVDAYRALFADAAALEDRNAR
FT                   YLERCHLVNAALAHGGVGAAVGVRAGLEELLTVLEQEPAEPVLLNQAGVLLAMFDGFAP
FT                   ALAVLEAALRLDPGLDDVAVNAAKIRQLLSARTRGRIDRSGELGRRAARVAARAMPAEG
FT                   MTVSLCMIVKDEEEMLPRSLAAAAPAVDEIVVVDTGSSDRTIEIATSYGARVIERPWTG
FT                   SFSEARNVGLDAATGDWLLILDADEVLVADDVPNLRALLGRTWREAFYVSAINHTGELD
FT                   DGTATTHSTVRLFRNRPGHRYSGRLHEQIVESLPQGAPERFEATPVRIEHFGYLGAVRD
FT                   AKEKSRRNIELLERQRDEGDSSAFMHFNLGSEYGALGDAEAALAEYERAVALLGDVAGG
FT                   SGFIGALTSRHVRALRVCGRGDDAIARAEEALERFPGFTDLVFEQAAAAQALGRTDDAI
FT                   AYFERCIAMGDAPSRYTATVGMGTYLPTIALAEIRHQHGDPAAAVELLDGALAAHPGFF
FT                   GLVLPFAAALLDDGAEPDVVVARVEELVAKLTPTVRFMLGTALYEHGETEAAEQQYREL
FT                   LAQQPSSGHARVALAEALLSQRRWDEAAAVAAELNDAEPHAGAARRSELFARITGGDHT
FT                   GAAAVLARPEPDDAVVLGPGDRALFAAWLAAAGGEREDSVLPAEAVGLLAVTLEALLRV
FT                   EEVDAFGTLVGLLDRCPIAPREQRELRAGMYLRRGFLASAAEEWLAVCGADATDVRALV
FT                   GLAQVAVAQGMTDEALDFAREAHALDPGDARATRLLQRLEPLAA"
     MAPRPLNGST PPLQAQAAAL LRRGDVDAYR ALFADAAALE DRNARYLERC HLVNAALAHG        60
     GVGAAVGVRA GLEELLTVLE QEPAEPVLLN QAGVLLAMFD GFAPALAVLE AALRLDPGLD       120
     DVAVNAAKIR QLLSARTRGR IDRSGELGRR AARVAARAMP AEGMTVSLCM IVKDEEEMLP       180
     RSLAAAAPAV DEIVVVDTGS SDRTIEIATS YGARVIERPW TGSFSEARNV GLDAATGDWL       240
     LILDADEVLV ADDVPNLRAL LGRTWREAFY VSAINHTGEL DDGTATTHST VRLFRNRPGH       300
     RYSGRLHEQI VESLPQGAPE RFEATPVRIE HFGYLGAVRD AKEKSRRNIE LLERQRDEGD       360
     SSAFMHFNLG SEYGALGDAE AALAEYERAV ALLGDVAGGS GFIGALTSRH VRALRVCGRG       420
     DDAIARAEEA LERFPGFTDL VFEQAAAAQA LGRTDDAIAY FERCIAMGDA PSRYTATVGM       480
     GTYLPTIALA EIRHQHGDPA AAVELLDGAL AAHPGFFGLV LPFAAALLDD GAEPDVVVAR       540
     VEELVAKLTP TVRFMLGTAL YEHGETEAAE QQYRELLAQQ PSSGHARVAL AEALLSQRRW       600
     DEAAAVAAEL NDAEPHAGAA RRSELFARIT GGDHTGAAAV LARPEPDDAV VLGPGDRALF       660
     AAWLAAAGGE REDSVLPAEA VGLLAVTLEA LLRVEEVDAF GTLVGLLDRC PIAPREQREL       720
     RAGMYLRRGF LASAAEEWLA VCGADATDVR ALVGLAQVAV AQGMTDEALD FAREAHALDP       780
     GDARATRLLQ RLEPLAA                                                      797
//

If you have problems or comments...

PBIL Back to PBIL home page