(data stored in ACNUC7421 zone)

EMBL: CP001854.PE31

CP001854.PE31        Location/Qualifiers
FT   CDS             34080..34415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0031"
FT                   /product="flagellin FlaG, putative"
FT                   /note="KEGG: dvl:Dvul_1637 flagellin FlaG, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48467"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="InterPro:IPR035924"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Y4"
FT                   /inference="similar to AA sequence:KEGG:Dvul_1637"
FT                   /protein_id="ADB48467.1"
FT                   /translation="MSLDVAPVGPSSFSAANDAQPSSRAQRPAAVVRQQVEVDVIPESP
FT                   PREVLDAIDAASRAYQKLRAQGRELHFAQDADSGRLTIEVRDLDGKLLRMIPPSRLLDV
FT                   ATGGTLD"
     MSLDVAPVGP SSFSAANDAQ PSSRAQRPAA VVRQQVEVDV IPESPPREVL DAIDAASRAY        60
     QKLRAQGREL HFAQDADSGR LTIEVRDLDG KLLRMIPPSR LLDVATGGTL D                111
//

If you have problems or comments...

PBIL Back to PBIL home page