(data stored in ACNUC7421 zone)

EMBL: CP001854.PE32

CP001854.PE32        Location/Qualifiers
FT   CDS             34415..35842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0032"
FT                   /product="flagellar hook-associated 2 domain protein"
FT                   /note="PFAM: flagellar hook-associated 2 domain protein;
FT                   flagellar hook-associated protein 2 domain protein; KEGG:
FT                   gsu:GSU3037 flagellar hook-associated protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48468"
FT                   /db_xref="GOA:D3F3Y5"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Y5"
FT                   /inference="protein motif:PFAM:PF07195"
FT                   /protein_id="ADB48468.1"
FT                   /translation="MAGINFSGIASGLNTGEIIEQMMAIEKRPRILLDNKQVLIETKQG
FT                   LLRDFQTKLRALQLAATDLRSVSLWTQTQSVESSDATKVSASSTSGAGVGGYQIEVSQL
FT                   ANAAQRTYTFTRPAADGTITVDGHSTAIRAGMTAQEVATAINTDRDAKVYAAATDDGTL
FT                   VLSSRATGDTGAGFIDVTSDGGAIAAKLDRGGARIERQGRDALYTLDGVSLRSSSNVIR
FT                   DGLAGVTLTLRGVTTASGPVTISVGAPGANVEAIRRKLEAFVEAYNATIDLIRGKLEER
FT                   TVPDPRSQQDIKNGVADPRTTAQKKAGTLFGDRQLAGMLSDLRQGIYSPVSGLPTGMDS
FT                   LSSIGISTGAFSASTSRDTLAGRLTIDTDRLTKALTEDPTGVRNLLQGVNNTDGWARRF
FT                   EGLLNDRTKSDGMLDNRIDGADDELRMLRRQMEQMDVRLALREKNLNAQFTALEVAISR
FT                   ARTQGDWLSGQLAGLNN"
     MAGINFSGIA SGLNTGEIIE QMMAIEKRPR ILLDNKQVLI ETKQGLLRDF QTKLRALQLA        60
     ATDLRSVSLW TQTQSVESSD ATKVSASSTS GAGVGGYQIE VSQLANAAQR TYTFTRPAAD       120
     GTITVDGHST AIRAGMTAQE VATAINTDRD AKVYAAATDD GTLVLSSRAT GDTGAGFIDV       180
     TSDGGAIAAK LDRGGARIER QGRDALYTLD GVSLRSSSNV IRDGLAGVTL TLRGVTTASG       240
     PVTISVGAPG ANVEAIRRKL EAFVEAYNAT IDLIRGKLEE RTVPDPRSQQ DIKNGVADPR       300
     TTAQKKAGTL FGDRQLAGML SDLRQGIYSP VSGLPTGMDS LSSIGISTGA FSASTSRDTL       360
     AGRLTIDTDR LTKALTEDPT GVRNLLQGVN NTDGWARRFE GLLNDRTKSD GMLDNRIDGA       420
     DDELRMLRRQ MEQMDVRLAL REKNLNAQFT ALEVAISRAR TQGDWLSGQL AGLNN            475
//

If you have problems or comments...

PBIL Back to PBIL home page