(data stored in ACNUC7421 zone)

EMBL: CP001854.PE33

CP001854.PE33        Location/Qualifiers
FT   CDS             35937..36338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0033"
FT                   /product="flagellar protein FliS"
FT                   /note="TIGRFAM: flagellar protein FliS; PFAM: flagellar
FT                   protein FliS; KEGG: pca:Pcar_1111 flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48469"
FT                   /db_xref="GOA:D3F3Y6"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Y6"
FT                   /inference="protein motif:TFAM:TIGR00208"
FT                   /protein_id="ADB48469.1"
FT                   /translation="MSTHLAASPQAYRESAVLTAPPERLVVMLYDGAGRFLHQAVVTMR
FT                   AGDIQTCHERLRRAEAIIDHLLETLDMSQGEVAQQLESIYIFCQRLIAEARIRLDPEKL
FT                   EQVRGLLAELREAWDQIGTAGSGSQAAPA"
     MSTHLAASPQ AYRESAVLTA PPERLVVMLY DGAGRFLHQA VVTMRAGDIQ TCHERLRRAE        60
     AIIDHLLETL DMSQGEVAQQ LESIYIFCQR LIAEARIRLD PEKLEQVRGL LAELREAWDQ       120
     IGTAGSGSQA APA                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page