(data stored in ACNUC7421 zone)

EMBL: CP001854.PE34

CP001854.PE34        Location/Qualifiers
FT   CDS             36335..36667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48470"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Y7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48470.1"
FT                   /translation="MISAEPYEALAQLAERELALVSASEPPSAEALVALMAERDALVAS
FT                   LPARAPPAAAPALARALALQERITAELTVHAAQVRRTLGSVEHGRRTMHGYAGGAPARG
FT                   ALDLTG"
     MISAEPYEAL AQLAERELAL VSASEPPSAE ALVALMAERD ALVASLPARA PPAAAPALAR        60
     ALALQERITA ELTVHAAQVR RTLGSVEHGR RTMHGYAGGA PARGALDLTG                  110
//

If you have problems or comments...

PBIL Back to PBIL home page