(data stored in ACNUC7421 zone)

EMBL: CP001854.PE35

CP001854.PE35        Location/Qualifiers
FT   CDS             36745..37098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0035"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgB;
FT                   PFAM: flagellar basal body rod protein; KEGG:
FT                   ent:Ent638_1587 flagellar basal body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48471"
FT                   /db_xref="GOA:D3F3Y8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Y8"
FT                   /inference="protein motif:TFAM:TIGR01396"
FT                   /protein_id="ADB48471.1"
FT                   /translation="MSLFDSTQLALESALRGSSMRQELLTNNLANINTPGYQRQDLDFH
FT                   SALQAAQASGNDPTEVTFRPSTDPSRVVRPDGSGLDADQESAALAKNTLEYQALVQVMG
FT                   ARTAIMQTALGVR"
     MSLFDSTQLA LESALRGSSM RQELLTNNLA NINTPGYQRQ DLDFHSALQA AQASGNDPTE        60
     VTFRPSTDPS RVVRPDGSGL DADQESAALA KNTLEYQALV QVMGARTAIM QTALGVR          117
//

If you have problems or comments...

PBIL Back to PBIL home page