(data stored in ACNUC7421 zone)

EMBL: CP001854.PE36

CP001854.PE36        Location/Qualifiers
FT   CDS             37098..37547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0036"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgC;
FT                   PFAM: protein of unknown function DUF1078 domain protein;
FT                   flagellar basal body rod protein; KEGG: gsu:GSU0408
FT                   flagellar basal-body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48472"
FT                   /db_xref="GOA:D3F3Y9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Y9"
FT                   /inference="protein motif:TFAM:TIGR01395"
FT                   /protein_id="ADB48472.1"
FT                   /translation="MGLFDAIDIAGSGLTAERLRMDVTAENLANAQTTRAADGGPYQRK
FT                   EVVLQQSGGSSFSTMLTGAIGGVRASEASKGVEVAGIVEDQTAQRQVYDPGHPDADPRG
FT                   YVAMPNVNPVTEMVDLISSSRSYEANVTAMQSAKQMFTKTLELLR"
     MGLFDAIDIA GSGLTAERLR MDVTAENLAN AQTTRAADGG PYQRKEVVLQ QSGGSSFSTM        60
     LTGAIGGVRA SEASKGVEVA GIVEDQTAQR QVYDPGHPDA DPRGYVAMPN VNPVTEMVDL       120
     ISSSRSYEAN VTAMQSAKQM FTKTLELLR                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page