(data stored in ACNUC7421 zone)

EMBL: CP001854.PE37

CP001854.PE37        Location/Qualifiers
FT   CDS             37544..37909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0037"
FT                   /product="flagellar hook-basal body complex protein FliE"
FT                   /note="PFAM: flagellar hook-basal body complex protein
FT                   FliE; KEGG: geo:Geob_0493 flagellar hook-basal body complex
FT                   subunit FliE"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48473"
FT                   /db_xref="GOA:D3F3Z0"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Z0"
FT                   /inference="protein motif:PFAM:PF02049"
FT                   /protein_id="ADB48473.1"
FT                   /translation="MIPAIDPSVVSGAGGAGGLGGEWQIQGVPDVPQAELLTPGVDGAQ
FT                   AGGGEGFGSMLANEIGKLSELQTHAAEAGQALATGTATDPVSAVVAVEKAQLAMQFAGQ
FT                   IRTRGAEALSEIFRTQI"
     MIPAIDPSVV SGAGGAGGLG GEWQIQGVPD VPQAELLTPG VDGAQAGGGE GFGSMLANEI        60
     GKLSELQTHA AEAGQALATG TATDPVSAVV AVEKAQLAMQ FAGQIRTRGA EALSEIFRTQ       120
     I                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page