(data stored in ACNUC7421 zone)

EMBL: CP001854.PE38

CP001854.PE38        Location/Qualifiers
FT   CDS             37913..39430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0038"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="TIGRFAM: flagellar M-ring protein FliF; PFAM:
FT                   secretory protein YscJ/FliF family protein; Flagellar
FT                   M-ring domain protein; KEGG: rpa:RPA1264 flagellar MS-ring
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48474"
FT                   /db_xref="GOA:D3F3Z1"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Z1"
FT                   /inference="protein motif:TFAM:TIGR00206"
FT                   /protein_id="ADB48474.1"
FT                   /translation="MPARALLANLSTRGKIVLAGGALAIVVVLFFLFQIATAPSYTTLL
FT                   TGMDPKDTGEVTAALDERGIAYELQNNGTALAVQKGQTAQARIALAGAGLPGNTNDGYK
FT                   ILDDQKMGTSNFQQNVNYQRALEGEIGTTIEEVDGVSSAQVQLVLPDREAQLFAENVNP
FT                   ATAAVLLSGASTLDEGQVRGIAQLVTNSVPGLKSEKVTITDSSGTMLWPTATSGSSSGL
FT                   LAKQAAEARYNQQTATNITAMLARTVGPDKVQVQVKADLDANEATQDRLVYGRDGTPLS
FT                   NRAERETLVSRGGRAGGPAGTAGNNPPVYAGQAGGDSDYRRESEDENLAVNKTVTRTRI
FT                   APGAVNRQQVAVLVDDSVPAAMLPQIRDAVMSAAGIDEDRGDVLTLGSIPFAELPRPAA
FT                   SSPVDDIWDYARYALLGMAALVFLALVARQLRKRENETLAGEPTWLREIESPRTLAELE
FT                   RFEEPVAPTQVLPLRSPENAARMQVEELVERDPERVAQHVRAWMQED"
     MPARALLANL STRGKIVLAG GALAIVVVLF FLFQIATAPS YTTLLTGMDP KDTGEVTAAL        60
     DERGIAYELQ NNGTALAVQK GQTAQARIAL AGAGLPGNTN DGYKILDDQK MGTSNFQQNV       120
     NYQRALEGEI GTTIEEVDGV SSAQVQLVLP DREAQLFAEN VNPATAAVLL SGASTLDEGQ       180
     VRGIAQLVTN SVPGLKSEKV TITDSSGTML WPTATSGSSS GLLAKQAAEA RYNQQTATNI       240
     TAMLARTVGP DKVQVQVKAD LDANEATQDR LVYGRDGTPL SNRAERETLV SRGGRAGGPA       300
     GTAGNNPPVY AGQAGGDSDY RRESEDENLA VNKTVTRTRI APGAVNRQQV AVLVDDSVPA       360
     AMLPQIRDAV MSAAGIDEDR GDVLTLGSIP FAELPRPAAS SPVDDIWDYA RYALLGMAAL       420
     VFLALVARQL RKRENETLAG EPTWLREIES PRTLAELERF EEPVAPTQVL PLRSPENAAR       480
     MQVEELVERD PERVAQHVRA WMQED                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page