(data stored in ACNUC7421 zone)

EMBL: CP001854.PE39

CP001854.PE39        Location/Qualifiers
FT   CDS             39438..40520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0039"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="TIGRFAM: flagellar motor switch protein FliG; PFAM:
FT                   flagellar motor switch protein FliG; KEGG: dvm:DvMF_2288
FT                   flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48475"
FT                   /db_xref="GOA:D3F3Z2"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Z2"
FT                   /inference="protein motif:TFAM:TIGR00207"
FT                   /protein_id="ADB48475.1"
FT                   /translation="MAIQLPAAGTAEDPAGVMPAPRRLPQRTPVRLKGRNKAAVLLVAL
FT                   GPEKAAEIFKHLRDEEIETLSLEMAKLNQIDHEAVGFVFDELVATVQAYDSLAAGGVDY
FT                   ARDVLERALGPERAAEIIGRLSTVIEMRPFEFLRRTPPEHIVTFLRAEAPQTIALVIAN
FT                   LHTTLAAQVLAHLPEEEQADIALRIARMSETPPDVVKEIEGVMRQKLASVVQQEYSSQG
FT                   GVKSLAEILNYTDRPTERNVLDTLTEQDAELGEEVRRLLFVFEDIAKLDDRSIQLVLRE
FT                   ADQRDLALALRGVDDDVRERILGNMSERGATLLREEMEYQPPQRKRVVEEAQGRIVAIV
FT                   RRLEDAGALVIGRGGSDTIV"
     MAIQLPAAGT AEDPAGVMPA PRRLPQRTPV RLKGRNKAAV LLVALGPEKA AEIFKHLRDE        60
     EIETLSLEMA KLNQIDHEAV GFVFDELVAT VQAYDSLAAG GVDYARDVLE RALGPERAAE       120
     IIGRLSTVIE MRPFEFLRRT PPEHIVTFLR AEAPQTIALV IANLHTTLAA QVLAHLPEEE       180
     QADIALRIAR MSETPPDVVK EIEGVMRQKL ASVVQQEYSS QGGVKSLAEI LNYTDRPTER       240
     NVLDTLTEQD AELGEEVRRL LFVFEDIAKL DDRSIQLVLR EADQRDLALA LRGVDDDVRE       300
     RILGNMSERG ATLLREEMEY QPPQRKRVVE EAQGRIVAIV RRLEDAGALV IGRGGSDTIV       360
//

If you have problems or comments...

PBIL Back to PBIL home page