(data stored in ACNUC7421 zone)

EMBL: CP001854.PE4

CP001854.PE4         Location/Qualifiers
FT   CDS             3800..4117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0004"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   gme:Gmet_2875 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48440"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYQ7"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ADB48440.1"
FT                   /translation="MSRRRAPRPLGEALGALQASLAPATLLAEVQRAWPAVAGEAIARE
FT                   AAPVSERGGTVTIACAAAVWAQELDLMAPMLIEKLNASIGRPAVKRLRCVTGAREGLRR
FT                   T"
     MSRRRAPRPL GEALGALQAS LAPATLLAEV QRAWPAVAGE AIAREAAPVS ERGGTVTIAC        60
     AAAVWAQELD LMAPMLIEKL NASIGRPAVK RLRCVTGARE GLRRT                       105
//

If you have problems or comments...

PBIL Back to PBIL home page