(data stored in ACNUC7421 zone)

EMBL: CP001854.PE40

CP001854.PE40        Location/Qualifiers
FT   CDS             40513..41130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0040"
FT                   /product="Flagellar assembly protein FliH/Type III
FT                   secretion system HrpE"
FT                   /note="PFAM: Flagellar assembly protein FliH/Type III
FT                   secretion system HrpE; KEGG: tbd:Tbd_1090 flagellar
FT                   assembly protein FliH"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48476"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Z3"
FT                   /inference="protein motif:PFAM:PF02108"
FT                   /protein_id="ADB48476.1"
FT                   /translation="MSDPATAAPYAFRQLEEPRPVSLREIEDPIANAHAEAERIREEAR
FT                   AQGYADGQAAALAAAQPPLEAALAALQQAVAGVEQVRDETAAAVERDAIELSLQLAEKI
FT                   VAGALAVESERIVDVVRGALRRLAERRRVTILVHPDDLETVRAATESFVTGLGGIEHCE
FT                   VQAERRITPGGASVRTEEGQIDATVSTQLMRARELVELELGE"
     MSDPATAAPY AFRQLEEPRP VSLREIEDPI ANAHAEAERI REEARAQGYA DGQAAALAAA        60
     QPPLEAALAA LQQAVAGVEQ VRDETAAAVE RDAIELSLQL AEKIVAGALA VESERIVDVV       120
     RGALRRLAER RRVTILVHPD DLETVRAATE SFVTGLGGIE HCEVQAERRI TPGGASVRTE       180
     EGQIDATVST QLMRARELVE LELGE                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page