(data stored in ACNUC7421 zone)

EMBL: CP001854.PE41

CP001854.PE41        Location/Qualifiers
FT   CDS             41141..42610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0041"
FT                   /product="flagellar protein export ATPase FliI"
FT                   /EC_number="7.1.2.2"
FT                   /note="KEGG: dde:Dde_0350 ATPase FliI/YscN; TIGRFAM:
FT                   flagellar protein export ATPase FliI; ATPase, FliI/YscN
FT                   family; PFAM: H+transporting two-sector ATPase alpha/beta
FT                   subunit central region; H+transporting two-sector ATPase
FT                   alpha/beta subunit domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48477"
FT                   /db_xref="GOA:D3F3Z4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Z4"
FT                   /inference="protein motif:TFAM:TIGR03496"
FT                   /protein_id="ADB48477.1"
FT                   /translation="MSPEDQTPDAVVAEQLGDRLKHVGNVLRASDLARRHGRVSDLIGL
FT                   VVEATGLQAEVGEICMVNGDRGHPPVPAEVVGFRGARTLLMPLGEMHGIGPATTTRATG
FT                   TPFRIRVGQDLLGRVIDGLGKPIDGMPRATNGHPRSTNASPPDPLDRPRIDQRVDLGVR
FT                   ALDALVPCGRGQRLGIFAGSGVGKSSLLGMIARSTTADVNVIALVGERGREVKEFVERD
FT                   LGDALSRSVVVVATSDQPALVRIKAAFTATAIAEHFRDQGNDVMLMMDSVTRFAMAQRE
FT                   VGLAIGEPPATRGYTPSVFAQLPRLLERSGTARTGSITGLYTVLVDGDDMNEPIADAVR
FT                   SILDGHVVLTRELAHASHYPAIDVLQSVSRLVGEIVSPEVRAAGQAVRQLMASYKEKED
FT                   LIAIGAYQGGTDPTVDAAIALRPQLDRFLKQRPDEKSSAAEADELLLDIAARIGEYAGV
FT                   GPEPAPADPAEQPASAPGGSAAAIPPLPNLA"
     MSPEDQTPDA VVAEQLGDRL KHVGNVLRAS DLARRHGRVS DLIGLVVEAT GLQAEVGEIC        60
     MVNGDRGHPP VPAEVVGFRG ARTLLMPLGE MHGIGPATTT RATGTPFRIR VGQDLLGRVI       120
     DGLGKPIDGM PRATNGHPRS TNASPPDPLD RPRIDQRVDL GVRALDALVP CGRGQRLGIF       180
     AGSGVGKSSL LGMIARSTTA DVNVIALVGE RGREVKEFVE RDLGDALSRS VVVVATSDQP       240
     ALVRIKAAFT ATAIAEHFRD QGNDVMLMMD SVTRFAMAQR EVGLAIGEPP ATRGYTPSVF       300
     AQLPRLLERS GTARTGSITG LYTVLVDGDD MNEPIADAVR SILDGHVVLT RELAHASHYP       360
     AIDVLQSVSR LVGEIVSPEV RAAGQAVRQL MASYKEKEDL IAIGAYQGGT DPTVDAAIAL       420
     RPQLDRFLKQ RPDEKSSAAE ADELLLDIAA RIGEYAGVGP EPAPADPAEQ PASAPGGSAA       480
     AIPPLPNLA                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page