(data stored in ACNUC7421 zone)

EMBL: CP001854.PE42

CP001854.PE42        Location/Qualifiers
FT   CDS             complement(42616..43371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48478"
FT                   /db_xref="GOA:D3F3Z5"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Z5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48478.1"
FT                   /translation="MPFAEIVIEIGGERALDHGANRAGFVLFAAFLLSFAFIRMSARLM
FT                   RSPKVPWWPGSVTTGDLHIHHLVFGIVLLLVAGFASIAFQPDSPWLEATAAVFGIGAGL
FT                   TLDEFALWLHLDDVYWSDEGRQSVDAVLFAALLGGLVLTGTVPFGDGGGVVGIVTTGLL
FT                   VIALSALALLKGKYVLGAAGLLFPLLSLTGAIRLAKPGTPWARWRYPEGSRKLARAQQR
FT                   ADHHAARLERWQDRIGGAPDKPSPRKPPP"
     MPFAEIVIEI GGERALDHGA NRAGFVLFAA FLLSFAFIRM SARLMRSPKV PWWPGSVTTG        60
     DLHIHHLVFG IVLLLVAGFA SIAFQPDSPW LEATAAVFGI GAGLTLDEFA LWLHLDDVYW       120
     SDEGRQSVDA VLFAALLGGL VLTGTVPFGD GGGVVGIVTT GLLVIALSAL ALLKGKYVLG       180
     AAGLLFPLLS LTGAIRLAKP GTPWARWRYP EGSRKLARAQ QRADHHAARL ERWQDRIGGA       240
     PDKPSPRKPP P                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page