(data stored in ACNUC7421 zone)

EMBL: CP001854.PE43

CP001854.PE43        Location/Qualifiers
FT   CDS             complement(43450..44379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0043"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mxa:MXAN_3578 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48479"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Z6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB48479.1"
FT                   /translation="METTTKRPLEGRVALVAGATRGAGRGIAVQLGAAGATVYATGRST
FT                   RASRREGDRPETIEETAELIDAAGGTGVAVRADHLEPEQVRAVVARIEREQGRLDVLVN
FT                   DIWGGDLLFRWETPLWEQSLDDGLKMLRLAIETHAITSHAALPLLLREPGGLVVEMTDG
FT                   TAEYNAANYRVSYFYDLAKTATLRMAFAQAHELGPRGATAVALTPGWLRSEAMLDTFMG
FT                   VTEETWRDALERVPHFCISESPAFVGRAVAALAADPERARWNGASLSSGQLAQVYGFTD
FT                   LDGSRPDAWRYVVEVQDPGRPADATGYR"
     METTTKRPLE GRVALVAGAT RGAGRGIAVQ LGAAGATVYA TGRSTRASRR EGDRPETIEE        60
     TAELIDAAGG TGVAVRADHL EPEQVRAVVA RIEREQGRLD VLVNDIWGGD LLFRWETPLW       120
     EQSLDDGLKM LRLAIETHAI TSHAALPLLL REPGGLVVEM TDGTAEYNAA NYRVSYFYDL       180
     AKTATLRMAF AQAHELGPRG ATAVALTPGW LRSEAMLDTF MGVTEETWRD ALERVPHFCI       240
     SESPAFVGRA VAALAADPER ARWNGASLSS GQLAQVYGFT DLDGSRPDAW RYVVEVQDPG       300
     RPADATGYR                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page