(data stored in ACNUC7421 zone)

EMBL: CP001854.PE44

CP001854.PE44        Location/Qualifiers
FT   CDS             44435..45391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0044"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein; KEGG:
FT                   bbt:BBta_6686 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48480"
FT                   /db_xref="GOA:D3F3Z7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Z7"
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /protein_id="ADB48480.1"
FT                   /translation="MRASRLVTLVLLLQARGPWTADELAERLEVSVRTVHRDVEALRAS
FT                   GVPIRGERGPAGGYRLPGGYRTRLTGLTPDEAEALFLAAPADALGLGGFLADAQLKLLA
FT                   ALPPQLRDRADRAAQLFHVDHRSWFGPDEQPPALGAIAGALWHGRRLRLVHRGRERVVD
FT                   PLGLVLKGPSWYLIGATERGERTFRVGRVERAVELEQEARRPPQFDLVAHWDAWSRAFE
FT                   DGLPYIAARVRVAPHKLGELRRVVDSRRRDLLPRHADGDEWLELEVWFERIEHAEGGLL
FT                   GLGAHVEVLAPPELRTRIEAHVATLARRYGVEHPSSS"
     MRASRLVTLV LLLQARGPWT ADELAERLEV SVRTVHRDVE ALRASGVPIR GERGPAGGYR        60
     LPGGYRTRLT GLTPDEAEAL FLAAPADALG LGGFLADAQL KLLAALPPQL RDRADRAAQL       120
     FHVDHRSWFG PDEQPPALGA IAGALWHGRR LRLVHRGRER VVDPLGLVLK GPSWYLIGAT       180
     ERGERTFRVG RVERAVELEQ EARRPPQFDL VAHWDAWSRA FEDGLPYIAA RVRVAPHKLG       240
     ELRRVVDSRR RDLLPRHADG DEWLELEVWF ERIEHAEGGL LGLGAHVEVL APPELRTRIE       300
     AHVATLARRY GVEHPSSS                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page