(data stored in ACNUC7421 zone)

EMBL: CP001854.PE46

CP001854.PE46        Location/Qualifiers
FT   CDS             45867..46601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0046"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   cja:CJA_2884 lytic murein transglycosylase, putative,
FT                   lmt23D"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48482"
FT                   /db_xref="GOA:D3F3Z9"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Z9"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ADB48482.1"
FT                   /translation="MSVAAVEGAAAPGTGAQAAIARIAELQTLVARAHGVPPVAAASAP
FT                   ATSFSSALAGAGVGQAIANSAAAGAPVTQPLPGATGAGSGLGGTPSPFDGLILAAAQKH
FT                   GLDPALLKGLIRAESNFDPTASSPAGAAGLVQLMPGTAASLGVTDRLDPAQSIDGGARY
FT                   LRQQLDAFGGDVTKALAAYNAGPGAVQRYNGVPPYAETQAYVQKVQAYADEYRVAPVAA
FT                   ALPAPTTLPTTAIPTTGSGSIT"
     MSVAAVEGAA APGTGAQAAI ARIAELQTLV ARAHGVPPVA AASAPATSFS SALAGAGVGQ        60
     AIANSAAAGA PVTQPLPGAT GAGSGLGGTP SPFDGLILAA AQKHGLDPAL LKGLIRAESN       120
     FDPTASSPAG AAGLVQLMPG TAASLGVTDR LDPAQSIDGG ARYLRQQLDA FGGDVTKALA       180
     AYNAGPGAVQ RYNGVPPYAE TQAYVQKVQA YADEYRVAPV AAALPAPTTL PTTAIPTTGS       240
     GSIT                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page