(data stored in ACNUC7421 zone)

EMBL: CP001854.PE47

CP001854.PE47        Location/Qualifiers
FT   CDS             46598..48046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0047"
FT                   /product="flagellar hook-length control protein"
FT                   /note="PFAM: flagellar hook-length control protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48483"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:D3F400"
FT                   /inference="protein motif:PFAM:PF02120"
FT                   /protein_id="ADB48483.1"
FT                   /translation="MSILIPPAPPPPAAAGPPKPGGRSAPPDGDPFASVLDQQARTATA
FT                   EGLAKQQEANDAKTVSGRDARPADGSPQQVGTDDVQPGAEGTDPAALAAALNGVLGVAT
FT                   TPATANAAVASAAAPPLPAAAAAAATTTAPVAAQVVPAATVDAPVAAPATAAPATPAPA
FT                   PAVPQPPSQPVVTTAPATAAATAPADVAPLATAVPAAAAVDAPESAPVQQPAAAAPSAA
FT                   AATAPAEQAGSGTTGGQTGNGATGDQRGAGQPAPTPGPAAVPGGDPAAAPQQPAEPAAA
FT                   STAAPNGGAASAPQPAAAASPSSAPIAPAAGQQLAAAHEASATGAATTRGAVTLEHAVE
FT                   TVRLAMRAGAERGVTHARISLSPQELGGIEIHLRHTADGIVAKVIADSAGAAQLLQQSG
FT                   GDLRRQLEQQGLNLLRLDIGASGEQAAHAGGQRGLGDPGSGGSSAGGPRTAGPDDAVLT
FT                   VERDAVPRGTTLALPNGALVDVLA"
     MSILIPPAPP PPAAAGPPKP GGRSAPPDGD PFASVLDQQA RTATAEGLAK QQEANDAKTV        60
     SGRDARPADG SPQQVGTDDV QPGAEGTDPA ALAAALNGVL GVATTPATAN AAVASAAAPP       120
     LPAAAAAAAT TTAPVAAQVV PAATVDAPVA APATAAPATP APAPAVPQPP SQPVVTTAPA       180
     TAAATAPADV APLATAVPAA AAVDAPESAP VQQPAAAAPS AAAATAPAEQ AGSGTTGGQT       240
     GNGATGDQRG AGQPAPTPGP AAVPGGDPAA APQQPAEPAA ASTAAPNGGA ASAPQPAAAA       300
     SPSSAPIAPA AGQQLAAAHE ASATGAATTR GAVTLEHAVE TVRLAMRAGA ERGVTHARIS       360
     LSPQELGGIE IHLRHTADGI VAKVIADSAG AAQLLQQSGG DLRRQLEQQG LNLLRLDIGA       420
     SGEQAAHAGG QRGLGDPGSG GSSAGGPRTA GPDDAVLTVE RDAVPRGTTL ALPNGALVDV       480
     LA                                                                      482
//

If you have problems or comments...

PBIL Back to PBIL home page