(data stored in ACNUC7421 zone)

EMBL: CP001854.PE48

CP001854.PE48        Location/Qualifiers
FT   CDS             48062..48520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0048"
FT                   /product="flagellar hook capping protein"
FT                   /note="PFAM: flagellar hook capping protein; KEGG:
FT                   sat:SYN_02840 flagellar hook capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48484"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="UniProtKB/TrEMBL:D3F401"
FT                   /inference="protein motif:PFAM:PF03963"
FT                   /protein_id="ADB48484.1"
FT                   /translation="MPVDPTNPVNNAPATYDNSTRRESFLGKDDFLKLLIGQMQNQDPL
FT                   NPTDGAEYMGQMTQFSILEQITNLGQTTQAAASNDYDAQAIRLIGQTVSYLARVNEDGR
FT                   SVLRSFTGRVESVTFTSSGPQLTIDGRTGILPVSLTKVGTDTAARGDE"
     MPVDPTNPVN NAPATYDNST RRESFLGKDD FLKLLIGQMQ NQDPLNPTDG AEYMGQMTQF        60
     SILEQITNLG QTTQAAASND YDAQAIRLIG QTVSYLARVN EDGRSVLRSF TGRVESVTFT       120
     SSGPQLTIDG RTGILPVSLT KVGTDTAARG DE                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page