(data stored in ACNUC7421 zone)

EMBL: CP001854.PE49

CP001854.PE49        Location/Qualifiers
FT   CDS             48517..48909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0049"
FT                   /product="flagellar operon protein"
FT                   /note="TIGRFAM: flagellar operon protein; KEGG:
FT                   gme:Gmet_3104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48485"
FT                   /db_xref="InterPro:IPR013367"
FT                   /db_xref="UniProtKB/TrEMBL:D3F402"
FT                   /inference="protein motif:TFAM:TIGR02530"
FT                   /protein_id="ADB48485.1"
FT                   /translation="MSLNVPNAALVPPGVAPVAQPAPGQATRRDAPIQGPSFSDVLRSR
FT                   TQGVEFSRHALQRLERRGIELGEQTLARLTDGVDRAAGKGSRESVVFVDGTAFVVSVRN
FT                   RTVITAVDPEHMREHVFTNIDSAVIA"
     MSLNVPNAAL VPPGVAPVAQ PAPGQATRRD APIQGPSFSD VLRSRTQGVE FSRHALQRLE        60
     RRGIELGEQT LARLTDGVDR AAGKGSRESV VFVDGTAFVV SVRNRTVITA VDPEHMREHV       120
     FTNIDSAVIA                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page