(data stored in ACNUC7421 zone)

EMBL: CP001854.PE5

CP001854.PE5         Location/Qualifiers
FT   CDS             4289..6715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: bba:Bd0004 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA topoisomerase type IIA subunit
FT                   B region 2 domain protein; DNA gyrase subunit B domain
FT                   protein; TOPRIM domain protein; ATP-binding region ATPase
FT                   domain protein; SMART: DNA topoisomerase II; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48441"
FT                   /db_xref="GOA:D3EYQ8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYQ8"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADB48441.1"
FT                   /translation="MATDKPAADKPTPSPSYDAQDITVLEGLEAVRKRPGMYIGSTGIR
FT                   GLHHLVYEVVDNSVDEALAGHASAVDVTIHPDNSITVVDNGRGIPVAMMEKEGKPAVEV
FT                   VLTVLHAGGKFGDGGGYKVSGGLHGVGVSVVNALSEQLRVEIFRDGFAWSQDYVRGAPQ
FT                   GQLERGEATSETGTTITFLPDDEIMESLDFDFTTLEERLRETAFLTRGLRISLTDERGE
FT                   RRHVEFQYDGGIQDFVAYLNENKDPVQRKIVYFSSESDEGAVEVAMQWNSSYQESVFSF
FT                   ANNINTHEGGSHLSGFRSALTRTINKYAREKGFLKERDANLAGEDVREGLTAVISAKLA
FT                   EPQFEGQTKTKLGNPGMQGFTESIVNKGLDEFLEENPQDARSVILKAVQAAQARSAARK
FT                   ARDLTRRKSALENSRLPGKLADCSVKDPALSEIFIVEGDSAGGSAKQGRDRSTQAILPL
FT                   RGKILNVERARIDKVLGNNEVQALITAIGTGVRDDFDLEKARYHKIILMTDADVDGAHI
FT                   RTLVLTLLFREMMPLIDAGFIYIAKPPLYKLKQGKNERYIEKDSELEEMLLSDKLERFS
FT                   IFDRTGAETRLTEARWKRFTRLLKQYGGWASALRALSSHDVVDFLHESGILEANVTDEG
FT                   ALARLLRQPEADGAAFSVELVGEDEVELTVRSIERKTGHARTRHVRRAMLQANEYRQLA
FT                   RVHDQLVQAVGTPPFDIRLGDHRETAVSFDELRSRVMDMAGRGVEINRFKGLGEMNAEQ
FT                   LRETTMDPATRTLARVTMEDAAAAERVFSMLMGDQVEPRRNFIEENASLVTNLDV"
     MATDKPAADK PTPSPSYDAQ DITVLEGLEA VRKRPGMYIG STGIRGLHHL VYEVVDNSVD        60
     EALAGHASAV DVTIHPDNSI TVVDNGRGIP VAMMEKEGKP AVEVVLTVLH AGGKFGDGGG       120
     YKVSGGLHGV GVSVVNALSE QLRVEIFRDG FAWSQDYVRG APQGQLERGE ATSETGTTIT       180
     FLPDDEIMES LDFDFTTLEE RLRETAFLTR GLRISLTDER GERRHVEFQY DGGIQDFVAY       240
     LNENKDPVQR KIVYFSSESD EGAVEVAMQW NSSYQESVFS FANNINTHEG GSHLSGFRSA       300
     LTRTINKYAR EKGFLKERDA NLAGEDVREG LTAVISAKLA EPQFEGQTKT KLGNPGMQGF       360
     TESIVNKGLD EFLEENPQDA RSVILKAVQA AQARSAARKA RDLTRRKSAL ENSRLPGKLA       420
     DCSVKDPALS EIFIVEGDSA GGSAKQGRDR STQAILPLRG KILNVERARI DKVLGNNEVQ       480
     ALITAIGTGV RDDFDLEKAR YHKIILMTDA DVDGAHIRTL VLTLLFREMM PLIDAGFIYI       540
     AKPPLYKLKQ GKNERYIEKD SELEEMLLSD KLERFSIFDR TGAETRLTEA RWKRFTRLLK       600
     QYGGWASALR ALSSHDVVDF LHESGILEAN VTDEGALARL LRQPEADGAA FSVELVGEDE       660
     VELTVRSIER KTGHARTRHV RRAMLQANEY RQLARVHDQL VQAVGTPPFD IRLGDHRETA       720
     VSFDELRSRV MDMAGRGVEI NRFKGLGEMN AEQLRETTMD PATRTLARVT MEDAAAAERV       780
     FSMLMGDQVE PRRNFIEENA SLVTNLDV                                          808
//

If you have problems or comments...

PBIL Back to PBIL home page