(data stored in ACNUC7421 zone)

EMBL: CP001854.PE50

CP001854.PE50        Location/Qualifiers
FT   CDS             48971..49852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0050"
FT                   /product="fagellar hook-basal body protein"
FT                   /note="TIGRFAM: fagellar hook-basal body protein; PFAM:
FT                   protein of unknown function DUF1078 domain protein;
FT                   flagellar basal body rod protein; KEGG: gme:Gmet_0431
FT                   flagellar basal body rod protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48486"
FT                   /db_xref="GOA:D3F403"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:D3F403"
FT                   /inference="protein motif:TFAM:TIGR03506"
FT                   /protein_id="ADB48486.1"
FT                   /translation="MMRGMFSAISGLKVNQTMLDVTANDLANVNTVAYKSSRTTFQDSL
FT                   AQLQRGAAGPGNGTGGSNALQIGLGVKLGSVDNIMTEGAPQTTGSPLDVYIEGSGWFRV
FT                   ANGTPPAVPTAFQWTRAGNFTTNSQGHLITSTGQYVVGRGATATPDGRGGFTYAPNATD
FT                   SYIQIPPGSTDVSISPDGGVSYVDRNRASPTFERRVTAGYIALGKFANEAGLQRNGGST
FT                   WSESAASGAATVDTPGVGGNGRTLAGMLEMSNVDLATQFTTMITAQRGFQANSRVISTS
FT                   DEMLQDLVNLKR"
     MMRGMFSAIS GLKVNQTMLD VTANDLANVN TVAYKSSRTT FQDSLAQLQR GAAGPGNGTG        60
     GSNALQIGLG VKLGSVDNIM TEGAPQTTGS PLDVYIEGSG WFRVANGTPP AVPTAFQWTR       120
     AGNFTTNSQG HLITSTGQYV VGRGATATPD GRGGFTYAPN ATDSYIQIPP GSTDVSISPD       180
     GGVSYVDRNR ASPTFERRVT AGYIALGKFA NEAGLQRNGG STWSESAASG AATVDTPGVG       240
     GNGRTLAGML EMSNVDLATQ FTTMITAQRG FQANSRVIST SDEMLQDLVN LKR              293
//

If you have problems or comments...

PBIL Back to PBIL home page