(data stored in ACNUC7421 zone)

EMBL: CP001854.PE52

CP001854.PE52        Location/Qualifiers
FT   CDS             50306..51103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0052"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   dde:Dde_3589 chemotaxis protein MotA"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48488"
FT                   /db_xref="GOA:D3F405"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D3F405"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ADB48488.1"
FT                   /translation="MKASTAIGLVGGLLAILLTGMLEGTSPATFINIPAIIIVLVGTFM
FT                   ATMASVGIDQMKRIPTLYKITFSPQEQDLRARVDLLVGIAEQARREGLLALDAQLGDID
FT                   DEFTRKGLQLVVDGTDPDLVREILEAEIDGMVARHAIGANTFEKAGGYAPTLGILGAVM
FT                   GLISVLGNLSDPDSLGPAISVAFIATLYGVGGANIVFLPICSRLKALSEEEVELRTLTL
FT                   DGILAVQAGDNPRVVADKLSSYVPPSERATADDDNVAPLREAA"
     MKASTAIGLV GGLLAILLTG MLEGTSPATF INIPAIIIVL VGTFMATMAS VGIDQMKRIP        60
     TLYKITFSPQ EQDLRARVDL LVGIAEQARR EGLLALDAQL GDIDDEFTRK GLQLVVDGTD       120
     PDLVREILEA EIDGMVARHA IGANTFEKAG GYAPTLGILG AVMGLISVLG NLSDPDSLGP       180
     AISVAFIATL YGVGGANIVF LPICSRLKAL SEEEVELRTL TLDGILAVQA GDNPRVVADK       240
     LSSYVPPSER ATADDDNVAP LREAA                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page