(data stored in ACNUC7421 zone)

EMBL: CP001854.PE53

CP001854.PE53        Location/Qualifiers
FT   CDS             51103..51975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0053"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: ppd:Ppro_3470
FT                   OmpA/MotB domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48489"
FT                   /db_xref="GOA:D3F406"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D3F406"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ADB48489.1"
FT                   /translation="MSARNRRGGRRRRGGGGHHGPDERWLITYADMLTLLLALFIVLYS
FT                   ISSLNTSKFEEMKTSLRDAFSGKIISGGEGIIETGVSATRDTPTSIVPNITPPRVQIAN
FT                   PRDSTAAAALAARIEDNEFRRIKAQIDAYARTHGLRDQVEAVVARRGLVVRLLTDQVLF
FT                   DSGFADLKSEGMPLLTHVGNLLVIDRIHPILVEGHTDDVPISTSRFESNWELSTARATE
FT                   VVRYLIDRGVPTRRFGASGYADLHPLGSNGTDRGRARNRRVEVVLQRLHLTSSQTTDAA
FT                   PDPQEGLNP"
     MSARNRRGGR RRRGGGGHHG PDERWLITYA DMLTLLLALF IVLYSISSLN TSKFEEMKTS        60
     LRDAFSGKII SGGEGIIETG VSATRDTPTS IVPNITPPRV QIANPRDSTA AAALAARIED       120
     NEFRRIKAQI DAYARTHGLR DQVEAVVARR GLVVRLLTDQ VLFDSGFADL KSEGMPLLTH       180
     VGNLLVIDRI HPILVEGHTD DVPISTSRFE SNWELSTARA TEVVRYLIDR GVPTRRFGAS       240
     GYADLHPLGS NGTDRGRARN RRVEVVLQRL HLTSSQTTDA APDPQEGLNP                  290
//

If you have problems or comments...

PBIL Back to PBIL home page