(data stored in ACNUC7421 zone)

EMBL: CP001854.PE54

CP001854.PE54        Location/Qualifiers
FT   CDS             51972..52415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0054"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48490"
FT                   /db_xref="GOA:D3F407"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:D3F407"
FT                   /inference="protein motif:PFAM:PF03748"
FT                   /protein_id="ADB48490.1"
FT                   /translation="MRKNVVVLVLVALIAGAGAAYTFAKPKKEVRHKIDGAVYVLPKEF
FT                   LVNLSDGRYAKMNVALVLDHGQPTAVEAGGHGAPPKPPEGFGTLEQEAVIRDIVTDVVT
FT                   NIDGDQLIRTEGRERVKAEILTKIRRTTDVRTEDVLITDVAVQ"
     MRKNVVVLVL VALIAGAGAA YTFAKPKKEV RHKIDGAVYV LPKEFLVNLS DGRYAKMNVA        60
     LVLDHGQPTA VEAGGHGAPP KPPEGFGTLE QEAVIRDIVT DVVTNIDGDQ LIRTEGRERV       120
     KAEILTKIRR TTDVRTEDVL ITDVAVQ                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page