(data stored in ACNUC7421 zone)

EMBL: CP001854.PE55

CP001854.PE55        Location/Qualifiers
FT   CDS             52426..52818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0055"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="TIGRFAM: flagellar motor switch protein FliN; PFAM:
FT                   surface presentation of antigens (SPOA) protein; KEGG:
FT                   cja:CJA_1724 flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48491"
FT                   /db_xref="GOA:D3F408"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:D3F408"
FT                   /inference="protein motif:TFAM:TIGR02480"
FT                   /protein_id="ADB48491.1"
FT                   /translation="MSHEMELPAFDRPTAANGSHTGQNDLGRLSDVPVELAVEIGRTRM
FT                   TVGETLELRPGSIVVLNRMAGEPVDLLVNGTPIAHGEVVVIDEEFGLRITDVLGAPAGE
FT                   QNGRASGEASAADASGQSPAEAPGTV"
     MSHEMELPAF DRPTAANGSH TGQNDLGRLS DVPVELAVEI GRTRMTVGET LELRPGSIVV        60
     LNRMAGEPVD LLVNGTPIAH GEVVVIDEEF GLRITDVLGA PAGEQNGRAS GEASAADASG       120
     QSPAEAPGTV                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page