(data stored in ACNUC7421 zone)

EMBL: CP001854.PE56

CP001854.PE56        Location/Qualifiers
FT   CDS             52896..53384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0056"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; SMART: CheW domain
FT                   protein; KEGG: dds:Ddes_1022 CheW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48492"
FT                   /db_xref="GOA:D3F409"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:D3F409"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ADB48492.1"
FT                   /translation="MSEGQTTRQLVVFSLGEEEYALPITQVHEIIRYTEPRSVASDVDW
FT                   VRGVISLRGKIVPVYDLASRLGFASERKDSAKIVIVETATDMAGVVVDDVEEVLTVESS
FT                   QIEDVPAADNESIEAIAKIDDRLVILLNPAGIFASAASVAAAAETSASGNGVADLVHA"
     MSEGQTTRQL VVFSLGEEEY ALPITQVHEI IRYTEPRSVA SDVDWVRGVI SLRGKIVPVY        60
     DLASRLGFAS ERKDSAKIVI VETATDMAGV VVDDVEEVLT VESSQIEDVP AADNESIEAI       120
     AKIDDRLVIL LNPAGIFASA ASVAAAAETS ASGNGVADLV HA                          162
//

If you have problems or comments...

PBIL Back to PBIL home page