(data stored in ACNUC7421 zone)

EMBL: CP001854.PE57

CP001854.PE57        Location/Qualifiers
FT   CDS             53423..54553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0057"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; SMART: response regulator receiver; KEGG:
FT                   dma:DMR_33480 chemotaxis response regulator
FT                   protein-glutamate methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48493"
FT                   /db_xref="GOA:D3F410"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:D3F410"
FT                   /inference="protein motif:PFAM:PF01339"
FT                   /protein_id="ADB48493.1"
FT                   /translation="MSSATATRVVVADDSGLMRRVVTATLEHSGFTVVGAAKDGDEALA
FT                   LCERERPDAMTLDLAMPGLDGIGVLRALRRQGERATPVVVVSAFSPAHGARAVDALAEG
FT                   AFDLVAKPAVGDGIERFTNELSDKVRLAAASRRGRTRPHGGRAGTGAAAAAGRAAAAPA
FT                   AARPRTAAGSGAVRRAERRVRAHAGTRRVVVIACSTGGPKALAELVPALPAPLGAGTLI
FT                   VQHMPPGFTNSLAARLDRASNLNVREAAGGEALDPKVALLAPGGAHLRLAEPSRVVSLS
FT                   DAPEIGGLRPRADLTIADAAKAFGERMVLVVLTGMGKDGLEGAREVRRRGGRVLVEAES
FT                   TCTVYGMPRAVAEADLADEILPLHELPAAIAAEAGA"
     MSSATATRVV VADDSGLMRR VVTATLEHSG FTVVGAAKDG DEALALCERE RPDAMTLDLA        60
     MPGLDGIGVL RALRRQGERA TPVVVVSAFS PAHGARAVDA LAEGAFDLVA KPAVGDGIER       120
     FTNELSDKVR LAAASRRGRT RPHGGRAGTG AAAAAGRAAA APAAARPRTA AGSGAVRRAE       180
     RRVRAHAGTR RVVVIACSTG GPKALAELVP ALPAPLGAGT LIVQHMPPGF TNSLAARLDR       240
     ASNLNVREAA GGEALDPKVA LLAPGGAHLR LAEPSRVVSL SDAPEIGGLR PRADLTIADA       300
     AKAFGERMVL VVLTGMGKDG LEGAREVRRR GGRVLVEAES TCTVYGMPRA VAEADLADEI       360
     LPLHELPAAI AAEAGA                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page